![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_5BAB0B6BC.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 135aa MW: 14931.9 Da PI: 10.58 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106.9 | 9.9e-34 | 56 | 114 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+ Traes_1DL_5BAB0B6BC.1 56 LDDGYRWRKYGQKAVKNSAFPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 114 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.0E-34 | 42 | 114 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.88E-29 | 48 | 115 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.564 | 51 | 116 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.7E-39 | 56 | 115 | IPR003657 | WRKY domain |
Pfam | PF03106 | 9.0E-27 | 57 | 114 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MVSGVTGAAA PESGAGSSSG VGREETKGKG SARARGSRKA SRPRFAFQTK SENDVLDDGY 60 RWRKYGQKAV KNSAFPRSYY RCTHHTCNVK KQVQRLAKDT SIVVTTYEGV HNHPCEKLME 120 ALNPILRQLQ FLSQL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-27 | 46 | 113 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-27 | 46 | 113 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ840412 | 1e-151 | DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006646294.1 | 4e-68 | PREDICTED: probable WRKY transcription factor 56 | ||||
Swissprot | Q9FFS3 | 8e-58 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | R7W8D5 | 2e-98 | R7W8D5_AEGTA; Putative WRKY transcription factor 24 | ||||
TrEMBL | W5AF49 | 2e-98 | W5AF49_WHEAT; Uncharacterized protein | ||||
STRING | MLOC_32433.1 | 2e-78 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 4e-57 | WRKY DNA-binding protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|